Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 10,656
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,648
  3. Avatar for BCC 13. BCC 1 pt. 10,429
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,820
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,500
  6. Avatar for incognito group 16. incognito group 1 pt. 9,075
  1. Avatar for dbuske 101. dbuske Lv 1 1 pt. 10,119
  2. Avatar for momadoc 102. momadoc Lv 1 1 pt. 10,031
  3. Avatar for Raborlatte 103. Raborlatte Lv 1 1 pt. 10,001
  4. Avatar for pfirth 104. pfirth Lv 1 1 pt. 9,970
  5. Avatar for froschi2 105. froschi2 Lv 1 1 pt. 9,966
  6. Avatar for Madis731 106. Madis731 Lv 1 1 pt. 9,964
  7. Avatar for fishercat 107. fishercat Lv 1 1 pt. 9,948
  8. Avatar for hys08111 108. hys08111 Lv 1 1 pt. 9,823
  9. Avatar for alyssa_d 109. alyssa_d Lv 1 1 pt. 9,820
  10. Avatar for xabxs 110. xabxs Lv 1 1 pt. 9,792

Comments