Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 10,656
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,648
  3. Avatar for BCC 13. BCC 1 pt. 10,429
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,820
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,500
  6. Avatar for incognito group 16. incognito group 1 pt. 9,075
  1. Avatar for dbuske 101. dbuske Lv 1 1 pt. 10,119
  2. Avatar for momadoc 102. momadoc Lv 1 1 pt. 10,031
  3. Avatar for Raborlatte 103. Raborlatte Lv 1 1 pt. 10,001
  4. Avatar for pfirth 104. pfirth Lv 1 1 pt. 9,970
  5. Avatar for froschi2 105. froschi2 Lv 1 1 pt. 9,966
  6. Avatar for Madis731 106. Madis731 Lv 1 1 pt. 9,964
  7. Avatar for fishercat 107. fishercat Lv 1 1 pt. 9,948
  8. Avatar for hys08111 108. hys08111 Lv 1 1 pt. 9,823
  9. Avatar for alyssa_d 109. alyssa_d Lv 1 1 pt. 9,820
  10. Avatar for xabxs 110. xabxs Lv 1 1 pt. 9,792

Comments