Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 10,656
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,648
  3. Avatar for BCC 13. BCC 1 pt. 10,429
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,820
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,500
  6. Avatar for incognito group 16. incognito group 1 pt. 9,075
  1. Avatar for ghiggins 111. ghiggins Lv 1 1 pt. 9,789
  2. Avatar for west.elsdon 112. west.elsdon Lv 1 1 pt. 9,772
  3. Avatar for 181818 113. 181818 Lv 1 1 pt. 9,754
  4. Avatar for Dranon 114. Dranon Lv 1 1 pt. 9,688
  5. Avatar for Vincera 115. Vincera Lv 1 1 pt. 9,685
  6. Avatar for aspadistra 116. aspadistra Lv 1 1 pt. 9,500
  7. Avatar for emhood42 117. emhood42 Lv 1 1 pt. 9,320
  8. Avatar for carinita 118. carinita Lv 1 1 pt. 9,248
  9. Avatar for fatelt 119. fatelt Lv 1 1 pt. 9,184
  10. Avatar for ingoneato 120. ingoneato Lv 1 1 pt. 9,075

Comments