Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 10,656
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,648
  3. Avatar for BCC 13. BCC 1 pt. 10,429
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,820
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,500
  6. Avatar for incognito group 16. incognito group 1 pt. 9,075
  1. Avatar for hpaege 11. hpaege Lv 1 67 pts. 11,606
  2. Avatar for erikviking 12. erikviking Lv 1 65 pts. 11,586
  3. Avatar for fiendish_ghoul 13. fiendish_ghoul Lv 1 62 pts. 11,563
  4. Avatar for O Seki To 14. O Seki To Lv 1 59 pts. 11,550
  5. Avatar for Aubade01 15. Aubade01 Lv 1 57 pts. 11,543
  6. Avatar for NinjaGreg 16. NinjaGreg Lv 1 54 pts. 11,529
  7. Avatar for nicobul 17. nicobul Lv 1 52 pts. 11,523
  8. Avatar for Bletchley Park 18. Bletchley Park Lv 1 50 pts. 11,518
  9. Avatar for reefyrob 19. reefyrob Lv 1 48 pts. 11,510
  10. Avatar for grogar7 20. grogar7 Lv 1 46 pts. 11,506

Comments