Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 10,656
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,648
  3. Avatar for BCC 13. BCC 1 pt. 10,429
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,820
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,500
  6. Avatar for incognito group 16. incognito group 1 pt. 9,075
  1. Avatar for AtOneMent 41. AtOneMent Lv 1 16 pts. 11,220
  2. Avatar for Deleted player 42. Deleted player pts. 11,210
  3. Avatar for KnaveErrant 43. KnaveErrant Lv 1 14 pts. 11,172
  4. Avatar for robgee 44. robgee Lv 1 14 pts. 11,144
  5. Avatar for pauldunn 45. pauldunn Lv 1 13 pts. 11,097
  6. Avatar for Kevin76 46. Kevin76 Lv 1 12 pts. 11,061
  7. Avatar for alcor29 47. alcor29 Lv 1 12 pts. 11,049
  8. Avatar for Blipperman 48. Blipperman Lv 1 11 pts. 11,034
  9. Avatar for mitarcher 49. mitarcher Lv 1 10 pts. 11,032
  10. Avatar for Superphosphate 50. Superphosphate Lv 1 10 pts. 11,030

Comments