Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 10,656
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,648
  3. Avatar for BCC 13. BCC 1 pt. 10,429
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,820
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,500
  6. Avatar for incognito group 16. incognito group 1 pt. 9,075
  1. Avatar for johngran 51. johngran Lv 1 9 pts. 11,018
  2. Avatar for katling 52. katling Lv 1 9 pts. 11,014
  3. Avatar for heather-1 53. heather-1 Lv 1 8 pts. 11,012
  4. Avatar for WBarme1234 54. WBarme1234 Lv 1 8 pts. 11,009
  5. Avatar for sciencewalker 55. sciencewalker Lv 1 7 pts. 10,992
  6. Avatar for DoctorSockrates 56. DoctorSockrates Lv 1 7 pts. 10,972
  7. Avatar for jamiexq 57. jamiexq Lv 1 6 pts. 10,967
  8. Avatar for dcrwheeler 58. dcrwheeler Lv 1 6 pts. 10,960
  9. Avatar for isaksson 59. isaksson Lv 1 6 pts. 10,934
  10. Avatar for guineapig 60. guineapig Lv 1 5 pts. 10,931

Comments