Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 10,656
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,648
  3. Avatar for BCC 13. BCC 1 pt. 10,429
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,820
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,500
  6. Avatar for incognito group 16. incognito group 1 pt. 9,075
  1. Avatar for weitzen 61. weitzen Lv 1 5 pts. 10,918
  2. Avatar for Glen B 62. Glen B Lv 1 5 pts. 10,864
  3. Avatar for drjr 63. drjr Lv 1 4 pts. 10,760
  4. Avatar for rezaefar 64. rezaefar Lv 1 4 pts. 10,734
  5. Avatar for diamonddays 65. diamonddays Lv 1 4 pts. 10,710
  6. Avatar for The_Otterable 66. The_Otterable Lv 1 4 pts. 10,656
  7. Avatar for Savas 67. Savas Lv 1 3 pts. 10,648
  8. Avatar for hada 68. hada Lv 1 3 pts. 10,633
  9. Avatar for khendarg 69. khendarg Lv 1 3 pts. 10,617
  10. Avatar for dalber 70. dalber Lv 1 3 pts. 10,614

Comments