Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,700
  2. Avatar for Go Science 2. Go Science 71 pts. 11,691
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 11,672
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 11,669
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 11,664
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 11,607
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 11,550
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 11,523
  9. Avatar for Contenders 9. Contenders 3 pts. 11,518
  10. Avatar for Team China 10. Team China 2 pts. 11,061
  1. Avatar for MayPeda2018 121. MayPeda2018 Lv 1 1 pt. 9,026
  2. Avatar for vrolletmail 122. vrolletmail Lv 1 1 pt. 8,874
  3. Avatar for toshiue 123. toshiue Lv 1 1 pt. 8,683
  4. Avatar for 01010011111 124. 01010011111 Lv 1 1 pt. 6,552
  5. Avatar for JMStiffler 125. JMStiffler Lv 1 1 pt. 5,434
  6. Avatar for franzemanz 126. franzemanz Lv 1 1 pt. 5,352
  7. Avatar for Susume 127. Susume Lv 1 1 pt. 5,352
  8. Avatar for USA SciEng Festival 128. USA SciEng Festival Lv 1 1 pt. 5,352
  9. Avatar for Matthew Hantsbarger 129. Matthew Hantsbarger Lv 1 1 pt. 5,352
  10. Avatar for baiyuncanggou 130. baiyuncanggou Lv 1 1 pt. 5,352

Comments