Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,700
  2. Avatar for Go Science 2. Go Science 71 pts. 11,691
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 11,672
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 11,669
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 11,664
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 11,607
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 11,550
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 11,523
  9. Avatar for Contenders 9. Contenders 3 pts. 11,518
  10. Avatar for Team China 10. Team China 2 pts. 11,061
  1. Avatar for Deleted player 81. Deleted player pts. 10,431
  2. Avatar for frezae 82. frezae Lv 1 1 pt. 10,429
  3. Avatar for atlas100 83. atlas100 Lv 1 1 pt. 10,405
  4. Avatar for Arne Heessels 84. Arne Heessels Lv 1 1 pt. 10,348
  5. Avatar for peanutbutterwithhoney 85. peanutbutterwithhoney Lv 1 1 pt. 10,342
  6. Avatar for rosado6135 86. rosado6135 Lv 1 1 pt. 10,321
  7. Avatar for abiogenesis 87. abiogenesis Lv 1 1 pt. 10,303
  8. Avatar for rabamino12358 88. rabamino12358 Lv 1 1 pt. 10,291
  9. Avatar for m9710797 89. m9710797 Lv 1 1 pt. 10,281
  10. Avatar for NotJim99 90. NotJim99 Lv 1 1 pt. 10,269

Comments