Placeholder image of a protein
Icon representing a puzzle

1516: Foldit Player Design with Electron Density

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
May 02, 2018
Expires
Max points
100
Description

This puzzle features a protein designed by fiendish_ghoul in Puzzle 1331! Last week, we challenged players to try to predict the structure of this protein from the sequence alone, in Puzzle 1511. We have since solved the crystal structure of this protein, and here we are providing players with the refined electron density map at a resolution of 1.54 Å. The crystal's electron density shows that this protein folds up exactly as fiendish_ghoul designed it, with RMSD of 0.9 Å among Cα atoms! Players can load in solutions from Puzzle 1511 to see how their predictions fit in the electron density map, or players can try building into the electron density from an extended chain.



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups


  1. Avatar for Go Science 100 pts. 15,136
  2. Avatar for Beta Folders 2. Beta Folders 63 pts. 15,126
  3. Avatar for Gargleblasters 3. Gargleblasters 37 pts. 15,097
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 21 pts. 15,087
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 15,014
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 13,723
  7. Avatar for Contenders 7. Contenders 2 pts. 13,334
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 12,270
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 10,818
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 10,468

  1. Avatar for fiendish_ghoul 11. fiendish_ghoul Lv 1 66 pts. 15,074
  2. Avatar for actiasluna 12. actiasluna Lv 1 63 pts. 15,058
  3. Avatar for drumpeter18yrs9yrs 13. drumpeter18yrs9yrs Lv 1 60 pts. 15,047
  4. Avatar for Anfinsen_slept_here 14. Anfinsen_slept_here Lv 1 57 pts. 15,032
  5. Avatar for frood66 15. frood66 Lv 1 55 pts. 15,014
  6. Avatar for alwen 16. alwen Lv 1 52 pts. 15,004
  7. Avatar for pauldunn 17. pauldunn Lv 1 50 pts. 14,994
  8. Avatar for Bautho 18. Bautho Lv 1 48 pts. 14,889
  9. Avatar for diamonddays 19. diamonddays Lv 1 46 pts. 14,864
  10. Avatar for WBarme1234 20. WBarme1234 Lv 1 43 pts. 14,126

Comments