Placeholder image of a protein
Icon representing a puzzle

1517: Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 10,225
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,155
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,572
  4. Avatar for :) 14. :) 1 pt. 8,954
  5. Avatar for Team China 15. Team China 1 pt. 8,508
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,234
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 6,163
  1. Avatar for Vinara 41. Vinara Lv 1 21 pts. 10,810
  2. Avatar for Norrjane 42. Norrjane Lv 1 20 pts. 10,798
  3. Avatar for robgee 43. robgee Lv 1 19 pts. 10,772
  4. Avatar for smilingone 44. smilingone Lv 1 18 pts. 10,757
  5. Avatar for alcor29 45. alcor29 Lv 1 17 pts. 10,745
  6. Avatar for isaksson 46. isaksson Lv 1 16 pts. 10,728
  7. Avatar for YeshuaLives 47. YeshuaLives Lv 1 16 pts. 10,716
  8. Avatar for carsonfb 48. carsonfb Lv 1 15 pts. 10,670
  9. Avatar for tarimo 49. tarimo Lv 1 14 pts. 10,663
  10. Avatar for katling 50. katling Lv 1 13 pts. 10,654

Comments