Placeholder image of a protein
Icon representing a puzzle

1517: Revisiting Puzzle 63: Spinach Protein

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,253
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,243
  3. Avatar for Go Science 3. Go Science 52 pts. 11,169
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 11,113
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 11,087
  6. Avatar for Contenders 6. Contenders 16 pts. 11,051
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,041
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 11,035
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 11,008
  10. Avatar for freefolder 10. freefolder 2 pts. 10,444

  1. Avatar for Vinara 41. Vinara Lv 1 21 pts. 10,810
  2. Avatar for Norrjane 42. Norrjane Lv 1 20 pts. 10,798
  3. Avatar for robgee 43. robgee Lv 1 19 pts. 10,772
  4. Avatar for smilingone 44. smilingone Lv 1 18 pts. 10,757
  5. Avatar for alcor29 45. alcor29 Lv 1 17 pts. 10,745
  6. Avatar for isaksson 46. isaksson Lv 1 16 pts. 10,728
  7. Avatar for YeshuaLives 47. YeshuaLives Lv 1 16 pts. 10,716
  8. Avatar for carsonfb 48. carsonfb Lv 1 15 pts. 10,670
  9. Avatar for tarimo 49. tarimo Lv 1 14 pts. 10,663
  10. Avatar for katling 50. katling Lv 1 13 pts. 10,654

Comments