Placeholder image of a protein
Icon representing a puzzle

1517: Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,253
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,243
  3. Avatar for Go Science 3. Go Science 52 pts. 11,169
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 11,113
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 11,087
  6. Avatar for Contenders 6. Contenders 16 pts. 11,051
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,041
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 11,035
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 11,008
  10. Avatar for freefolder 10. freefolder 2 pts. 10,444
  1. Avatar for riboseby 111. riboseby Lv 1 1 pt. 7,157
  2. Avatar for NotJim99 112. NotJim99 Lv 1 1 pt. 7,095
  3. Avatar for bzipitidoo 113. bzipitidoo Lv 1 1 pt. 7,054
  4. Avatar for pfirth 114. pfirth Lv 1 1 pt. 7,050
  5. Avatar for boondog 115. boondog Lv 1 1 pt. 6,968
  6. Avatar for momadoc 116. momadoc Lv 1 1 pt. 6,810
  7. Avatar for Sydefecks 117. Sydefecks Lv 1 1 pt. 6,757
  8. Avatar for 01010011111 118. 01010011111 Lv 1 1 pt. 6,743
  9. Avatar for parsnip 119. parsnip Lv 1 1 pt. 6,682
  10. Avatar for Anamfija 120. Anamfija Lv 1 1 pt. 6,602

Comments