Placeholder image of a protein
Icon representing a puzzle

1517: Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,253
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,243
  3. Avatar for Go Science 3. Go Science 52 pts. 11,169
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 11,113
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 11,087
  6. Avatar for Contenders 6. Contenders 16 pts. 11,051
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,041
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 11,035
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 11,008
  10. Avatar for freefolder 10. freefolder 2 pts. 10,444
  1. Avatar for chenatf 141. chenatf Lv 1 1 pt. 3,123
  2. Avatar for Vincera 142. Vincera Lv 1 1 pt. 0
  3. Avatar for joshmiller 143. joshmiller Lv 1 1 pt. 0
  4. Avatar for phi161 144. phi161 Lv 1 1 pt. 0
  5. Avatar for 20088299_Brand 145. 20088299_Brand Lv 1 1 pt. 0
  6. Avatar for mess1234 146. mess1234 Lv 1 1 pt. 0
  7. Avatar for rmoretti 147. rmoretti Lv 1 1 pt. 0

Comments