Placeholder image of a protein
Icon representing a puzzle

1520: Revisiting Puzzle 64: Thioredoxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Cannabis Crew 11. Cannabis Crew 2 pts. 11,240
  2. Avatar for Team China 12. Team China 1 pt. 11,176
  3. Avatar for Deleted group 13. Deleted group pts. 10,972
  4. Avatar for Androids 14. Androids 1 pt. 10,944
  5. Avatar for Deleted group 15. Deleted group pts. 10,853
  6. Avatar for freefolder 16. freefolder 1 pt. 10,837
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 10,793
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 10,629
  9. Avatar for Window Group 19. Window Group 1 pt. 7,782
  1. Avatar for SouperGenious 81. SouperGenious Lv 1 3 pts. 11,273
  2. Avatar for jamiexq 82. jamiexq Lv 1 3 pts. 11,272
  3. Avatar for leehaggis 83. leehaggis Lv 1 3 pts. 11,260
  4. Avatar for DoctorSockrates 84. DoctorSockrates Lv 1 3 pts. 11,259
  5. Avatar for emdee314 85. emdee314 Lv 1 2 pts. 11,257
  6. Avatar for heather-1 86. heather-1 Lv 1 2 pts. 11,252
  7. Avatar for Lord_c_nu 87. Lord_c_nu Lv 1 2 pts. 11,240
  8. Avatar for ManVsYard 88. ManVsYard Lv 1 2 pts. 11,230
  9. Avatar for pandapharmd 89. pandapharmd Lv 1 2 pts. 11,220
  10. Avatar for hada 90. hada Lv 1 2 pts. 11,205

Comments