Placeholder image of a protein
Icon representing a puzzle

1520: Revisiting Puzzle 64: Thioredoxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 11,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 11,787
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 11,747
  4. Avatar for Go Science 4. Go Science 41 pts. 11,746
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 11,682
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 11,658
  7. Avatar for Contenders 7. Contenders 14 pts. 11,626
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 11,603
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 11,594
  10. Avatar for Russian team 10. Russian team 4 pts. 11,511
  1. Avatar for Dr.Ashford 131. Dr.Ashford Lv 1 1 pt. 10,633
  2. Avatar for Savas 132. Savas Lv 1 1 pt. 10,629
  3. Avatar for frostschutz 133. frostschutz Lv 1 1 pt. 10,609
  4. Avatar for dbuske 134. dbuske Lv 1 1 pt. 10,548
  5. Avatar for Deleted player 135. Deleted player pts. 10,352
  6. Avatar for Mike Cassidy 136. Mike Cassidy Lv 1 1 pt. 10,194
  7. Avatar for rabamino12358 137. rabamino12358 Lv 1 1 pt. 10,115
  8. Avatar for Vincera 138. Vincera Lv 1 1 pt. 9,916
  9. Avatar for 16ebnest 139. 16ebnest Lv 1 1 pt. 9,748
  10. Avatar for Simek 140. Simek Lv 1 1 pt. 9,533

Comments