Placeholder image of a protein
Icon representing a puzzle

1520: Revisiting Puzzle 64: Thioredoxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 11,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 11,787
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 11,747
  4. Avatar for Go Science 4. Go Science 41 pts. 11,746
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 11,682
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 11,658
  7. Avatar for Contenders 7. Contenders 14 pts. 11,626
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 11,603
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 11,594
  10. Avatar for Russian team 10. Russian team 4 pts. 11,511
  1. Avatar for psycho-hiyokon 141. psycho-hiyokon Lv 1 1 pt. 8,814
  2. Avatar for JMStiffler 142. JMStiffler Lv 1 1 pt. 8,152
  3. Avatar for west.elsdon 143. west.elsdon Lv 1 1 pt. 7,846
  4. Avatar for jflat06 144. jflat06 Lv 1 1 pt. 7,782
  5. Avatar for 01010011111 145. 01010011111 Lv 1 1 pt. 7,782
  6. Avatar for Hollinas 146. Hollinas Lv 1 1 pt. 7,738
  7. Avatar for Madde 147. Madde Lv 1 1 pt. 7,738
  8. Avatar for baiyuncanggou 148. baiyuncanggou Lv 1 1 pt. 7,738
  9. Avatar for toshiue 149. toshiue Lv 1 1 pt. 7,738
  10. Avatar for u6175842 150. u6175842 Lv 1 1 pt. 7,738

Comments