Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Deleted group 12. Deleted group pts. 9,697
  2. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,609
  3. Avatar for freefolder 14. freefolder 1 pt. 9,580
  4. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,491
  5. Avatar for Deleted group 16. Deleted group pts. 9,445
  6. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,426

  1. Avatar for kludbrook 101. kludbrook Lv 1 1 pt. 9,641
  2. Avatar for AtOneMent 102. AtOneMent Lv 1 1 pt. 9,641
  3. Avatar for Superphosphate 103. Superphosphate Lv 1 1 pt. 9,628
  4. Avatar for uihcv 104. uihcv Lv 1 1 pt. 9,619
  5. Avatar for Savas 105. Savas Lv 1 1 pt. 9,609
  6. Avatar for Keresto 106. Keresto Lv 1 1 pt. 9,608
  7. Avatar for gstelle 107. gstelle Lv 1 1 pt. 9,595
  8. Avatar for ViJay7019 108. ViJay7019 Lv 1 1 pt. 9,589
  9. Avatar for slash2314 109. slash2314 Lv 1 1 pt. 9,583
  10. Avatar for pfirth 110. pfirth Lv 1 1 pt. 9,581

Comments