Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,793
  2. Avatar for Deleted group 12. Deleted group pts. 9,697
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,609
  4. Avatar for freefolder 14. freefolder 1 pt. 9,580
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,491
  6. Avatar for Deleted group 16. Deleted group pts. 9,445
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,426
  1. Avatar for bzipitidoo 121. bzipitidoo Lv 1 1 pt. 9,485
  2. Avatar for parsnip 122. parsnip Lv 1 1 pt. 9,456
  3. Avatar for The_Otterable 123. The_Otterable Lv 1 1 pt. 9,445
  4. Avatar for Vocaloid LB 124. Vocaloid LB Lv 1 1 pt. 9,440
  5. Avatar for momadoc 125. momadoc Lv 1 1 pt. 9,434
  6. Avatar for doctaven 126. doctaven Lv 1 1 pt. 9,426
  7. Avatar for kkaaggii 127. kkaaggii Lv 1 1 pt. 9,426
  8. Avatar for leonoel 128. leonoel Lv 1 1 pt. 9,425
  9. Avatar for navn 129. navn Lv 1 1 pt. 9,423
  10. Avatar for Chaperonski 130. Chaperonski Lv 1 1 pt. 9,420

Comments