Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,793
  2. Avatar for Deleted group 12. Deleted group pts. 9,697
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,609
  4. Avatar for freefolder 14. freefolder 1 pt. 9,580
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,491
  6. Avatar for Deleted group 16. Deleted group pts. 9,445
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,426
  1. Avatar for joelikespcs 141. joelikespcs Lv 1 1 pt. 9,050
  2. Avatar for otomoa16 142. otomoa16 Lv 1 1 pt. 9,005
  3. Avatar for Noidor 143. Noidor Lv 1 1 pt. 8,936
  4. Avatar for Procka 144. Procka Lv 1 1 pt. 8,822
  5. Avatar for cubelet 145. cubelet Lv 1 1 pt. 8,806
  6. Avatar for Sii 146. Sii Lv 1 1 pt. 8,750
  7. Avatar for eromana 147. eromana Lv 1 1 pt. 8,546
  8. Avatar for joshmiller 148. joshmiller Lv 1 1 pt. 7,832
  9. Avatar for Matthew Hantsbarger 149. Matthew Hantsbarger Lv 1 1 pt. 7,737
  10. Avatar for baiyuncanggou 150. baiyuncanggou Lv 1 1 pt. 7,737

Comments