Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Deleted group 12. Deleted group pts. 9,697
  2. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,609
  3. Avatar for freefolder 14. freefolder 1 pt. 9,580
  4. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,491
  5. Avatar for Deleted group 16. Deleted group pts. 9,445
  6. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,426

  1. Avatar for NinjaGreg 21. NinjaGreg Lv 1 50 pts. 10,188
  2. Avatar for YeshuaLives 22. YeshuaLives Lv 1 49 pts. 10,185
  3. Avatar for andrewxc 23. andrewxc Lv 1 47 pts. 10,176
  4. Avatar for pvc78 24. pvc78 Lv 1 45 pts. 10,175
  5. Avatar for christioanchauvin 25. christioanchauvin Lv 1 43 pts. 10,173
  6. Avatar for Deleted player 26. Deleted player pts. 10,169
  7. Avatar for O Seki To 27. O Seki To Lv 1 40 pts. 10,167
  8. Avatar for robgee 28. robgee Lv 1 39 pts. 10,165
  9. Avatar for actiasluna 29. actiasluna Lv 1 37 pts. 10,165
  10. Avatar for dcrwheeler 30. dcrwheeler Lv 1 36 pts. 10,164

Comments