Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Deleted group 12. Deleted group pts. 9,697
  2. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,609
  3. Avatar for freefolder 14. freefolder 1 pt. 9,580
  4. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,491
  5. Avatar for Deleted group 16. Deleted group pts. 9,445
  6. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,426

  1. Avatar for SaraL 41. SaraL Lv 1 23 pts. 10,110
  2. Avatar for toshiue 42. toshiue Lv 1 22 pts. 10,109
  3. Avatar for silent gene 43. silent gene Lv 1 21 pts. 10,106
  4. Avatar for Blipperman 44. Blipperman Lv 1 20 pts. 10,099
  5. Avatar for Enzyme 45. Enzyme Lv 1 19 pts. 10,093
  6. Avatar for petetrig 46. petetrig Lv 1 18 pts. 10,090
  7. Avatar for Museka 47. Museka Lv 1 17 pts. 10,082
  8. Avatar for Crossed Sticks 48. Crossed Sticks Lv 1 17 pts. 10,082
  9. Avatar for rezaefar 49. rezaefar Lv 1 16 pts. 10,079
  10. Avatar for sciencewalker 50. sciencewalker Lv 1 15 pts. 10,076

Comments