Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Deleted group 12. Deleted group pts. 9,697
  2. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,609
  3. Avatar for freefolder 14. freefolder 1 pt. 9,580
  4. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,491
  5. Avatar for Deleted group 16. Deleted group pts. 9,445
  6. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,426

  1. Avatar for isaksson 61. isaksson Lv 1 9 pts. 10,014
  2. Avatar for leehaggis 62. leehaggis Lv 1 9 pts. 10,005
  3. Avatar for Deleted player 63. Deleted player pts. 10,001
  4. Avatar for hada 64. hada Lv 1 8 pts. 9,981
  5. Avatar for altejoh 65. altejoh Lv 1 7 pts. 9,979
  6. Avatar for LavenderSky 66. LavenderSky Lv 1 7 pts. 9,976
  7. Avatar for gdnskye 67. gdnskye Lv 1 7 pts. 9,953
  8. Avatar for Deleted player 68. Deleted player pts. 9,943
  9. Avatar for Ladybug_dk 69. Ladybug_dk Lv 1 6 pts. 9,936
  10. Avatar for manu8170 70. manu8170 Lv 1 6 pts. 9,933

Comments