Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,793
  2. Avatar for Deleted group 12. Deleted group pts. 9,697
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,609
  4. Avatar for freefolder 14. freefolder 1 pt. 9,580
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,491
  6. Avatar for Deleted group 16. Deleted group pts. 9,445
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,426
  1. Avatar for atlas100 71. atlas100 Lv 1 5 pts. 9,915
  2. Avatar for froggs554 72. froggs554 Lv 1 5 pts. 9,913
  3. Avatar for severin333 73. severin333 Lv 1 5 pts. 9,900
  4. Avatar for frostschutz 74. frostschutz Lv 1 5 pts. 9,900
  5. Avatar for stomjoh 75. stomjoh Lv 1 4 pts. 9,893
  6. Avatar for Arne Heessels 76. Arne Heessels Lv 1 4 pts. 9,891
  7. Avatar for tarimo 77. tarimo Lv 1 4 pts. 9,879
  8. Avatar for Deleted player 78. Deleted player pts. 9,876
  9. Avatar for mitarcher 79. mitarcher Lv 1 3 pts. 9,872
  10. Avatar for ourtown 80. ourtown Lv 1 3 pts. 9,870

Comments