Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Deleted group 12. Deleted group pts. 9,697
  2. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,609
  3. Avatar for freefolder 14. freefolder 1 pt. 9,580
  4. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,491
  5. Avatar for Deleted group 16. Deleted group pts. 9,445
  6. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,426

  1. Avatar for keithv 81. keithv Lv 1 3 pts. 9,855
  2. Avatar for Merf 82. Merf Lv 1 3 pts. 9,842
  3. Avatar for katling 83. katling Lv 1 3 pts. 9,837
  4. Avatar for Mao Mao 84. Mao Mao Lv 1 3 pts. 9,829
  5. Avatar for alwen 85. alwen Lv 1 2 pts. 9,828
  6. Avatar for jobo0502 86. jobo0502 Lv 1 2 pts. 9,818
  7. Avatar for alyssa_d 87. alyssa_d Lv 1 2 pts. 9,797
  8. Avatar for nathanmills 88. nathanmills Lv 1 2 pts. 9,793
  9. Avatar for anaserra 89. anaserra Lv 1 2 pts. 9,761
  10. Avatar for Jesse Pinkman 90. Jesse Pinkman Lv 1 2 pts. 9,757

Comments