1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Summary

• Created: May 21, 2018
• Expires: May 28, 2018 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

• 1. Beta Folders 100 pts. 10,280
• 2. Go Science 73 pts. 10,258
• 3. Anthropic Dreams 52 pts. 10,251
• 4. Contenders 36 pts. 10,221
• 5. Void Crushers 24 pts. 10,217
• 6. L'Alliance Francophone 16 pts. 10,202
• 7. Marvin's bunch 10 pts. 10,198
• 8. Gargleblasters 6 pts. 10,197
• 9. HMT heritage 4 pts. 10,167
• 10. Trinity Biology 2 pts. 9,797

Top soloists

• 31. weitzen 34 pts. 10,156
• 32. eusair 33 pts. 10,155
• 33. Timo van der Laan 32 pts. 10,153
• 34. diamonddays 30 pts. 10,145
• 35. Alistair69 29 pts. 10,136
• 36. carsonfb 28 pts. 10,134
• 37. fiendish_ghoul 27 pts. 10,133
• 38. drjr 26 pts. 10,133
• 39. TastyMunchies 25 pts. 10,132
• 40. DoctorSockrates 24 pts. 10,131