Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,280
  2. Avatar for Go Science 2. Go Science 73 pts. 10,258
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,251
  4. Avatar for Contenders 4. Contenders 36 pts. 10,221
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 10,217
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,202
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 10,198
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,197
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 10,167
  10. Avatar for Trinity Biology 10. Trinity Biology 2 pts. 9,797
  1. Avatar for Anfinsen_slept_here 51. Anfinsen_slept_here Lv 1 15 pts. 10,075
  2. Avatar for phi16 52. phi16 Lv 1 14 pts. 10,072
  3. Avatar for MicElephant 53. MicElephant Lv 1 13 pts. 10,072
  4. Avatar for Glen B 54. Glen B Lv 1 13 pts. 10,070
  5. Avatar for WBarme1234 55. WBarme1234 Lv 1 12 pts. 10,070
  6. Avatar for dbuske 56. dbuske Lv 1 11 pts. 10,047
  7. Avatar for cbwest 57. cbwest Lv 1 11 pts. 10,046
  8. Avatar for alcor29 58. alcor29 Lv 1 10 pts. 10,029
  9. Avatar for cobaltteal 59. cobaltteal Lv 1 10 pts. 10,016
  10. Avatar for Vinara 60. Vinara Lv 1 9 pts. 10,016

Comments