Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Cannabis Crew 11. Cannabis Crew 1 pt. 8,412
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,179
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,767
  4. Avatar for BCC 14. BCC 1 pt. 6,831
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 0
  6. Avatar for Team China 16. Team China 1 pt. 0
  1. Avatar for actiasluna
    1. actiasluna Lv 1
    100 pts. 10,107
  2. Avatar for mirp 2. mirp Lv 1 97 pts. 10,071
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 94 pts. 10,035
  4. Avatar for bertro 4. bertro Lv 1 91 pts. 10,031
  5. Avatar for Timo van der Laan 5. Timo van der Laan Lv 1 89 pts. 10,017
  6. Avatar for isaksson 6. isaksson Lv 1 86 pts. 10,009
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 83 pts. 10,004
  8. Avatar for Galaxie 8. Galaxie Lv 1 80 pts. 9,956
  9. Avatar for LociOiling 9. LociOiling Lv 1 78 pts. 9,949
  10. Avatar for grogar7 10. grogar7 Lv 1 75 pts. 9,895

Comments