Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,107
  2. Avatar for Go Science 2. Go Science 71 pts. 10,106
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,031
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 10,017
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 9,957
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,841
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,710
  8. Avatar for Contenders 8. Contenders 5 pts. 9,620
  9. Avatar for Mojo Risin' 9. Mojo Risin' 3 pts. 8,979
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 2 pts. 8,745

  1. Avatar for actiasluna
    1. actiasluna Lv 1
    100 pts. 10,107
  2. Avatar for mirp 2. mirp Lv 1 97 pts. 10,071
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 94 pts. 10,035
  4. Avatar for bertro 4. bertro Lv 1 91 pts. 10,031
  5. Avatar for Timo van der Laan 5. Timo van der Laan Lv 1 89 pts. 10,017
  6. Avatar for isaksson 6. isaksson Lv 1 86 pts. 10,009
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 83 pts. 10,004
  8. Avatar for Galaxie 8. Galaxie Lv 1 80 pts. 9,956
  9. Avatar for LociOiling 9. LociOiling Lv 1 78 pts. 9,949
  10. Avatar for grogar7 10. grogar7 Lv 1 75 pts. 9,895

Comments