Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Cannabis Crew 11. Cannabis Crew 1 pt. 8,412
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,179
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,767
  4. Avatar for BCC 14. BCC 1 pt. 6,831
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 0
  6. Avatar for Team China 16. Team China 1 pt. 0
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,106
  2. Avatar for toshiue 2. toshiue Lv 1 84 pts. 10,105
  3. Avatar for Skippysk8s 3. Skippysk8s Lv 1 70 pts. 10,104
  4. Avatar for mirp 4. mirp Lv 1 58 pts. 10,104
  5. Avatar for NinjaGreg 5. NinjaGreg Lv 1 48 pts. 10,065
  6. Avatar for ViJay7019 6. ViJay7019 Lv 1 39 pts. 10,050
  7. Avatar for actiasluna 7. actiasluna Lv 1 32 pts. 10,050
  8. Avatar for isaksson 8. isaksson Lv 1 26 pts. 10,041
  9. Avatar for sciencewalker 9. sciencewalker Lv 1 20 pts. 10,032
  10. Avatar for smilingone 10. smilingone Lv 1 16 pts. 10,019

Comments