Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,107
  2. Avatar for Go Science 2. Go Science 71 pts. 10,106
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,031
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 10,017
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 9,957
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,841
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,710
  8. Avatar for Contenders 8. Contenders 5 pts. 9,620
  9. Avatar for Mojo Risin' 9. Mojo Risin' 3 pts. 8,979
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 2 pts. 8,745
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,106
  2. Avatar for toshiue 2. toshiue Lv 1 84 pts. 10,105
  3. Avatar for Skippysk8s 3. Skippysk8s Lv 1 70 pts. 10,104
  4. Avatar for mirp 4. mirp Lv 1 58 pts. 10,104
  5. Avatar for NinjaGreg 5. NinjaGreg Lv 1 48 pts. 10,065
  6. Avatar for ViJay7019 6. ViJay7019 Lv 1 39 pts. 10,050
  7. Avatar for actiasluna 7. actiasluna Lv 1 32 pts. 10,050
  8. Avatar for isaksson 8. isaksson Lv 1 26 pts. 10,041
  9. Avatar for sciencewalker 9. sciencewalker Lv 1 20 pts. 10,032
  10. Avatar for smilingone 10. smilingone Lv 1 16 pts. 10,019

Comments