Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,107
  2. Avatar for Go Science 2. Go Science 71 pts. 10,106
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,031
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 10,017
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 9,957
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,841
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,710
  8. Avatar for Contenders 8. Contenders 5 pts. 9,620
  9. Avatar for Mojo Risin' 9. Mojo Risin' 3 pts. 8,979
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 2 pts. 8,745
  1. Avatar for LociOiling 11. LociOiling Lv 1 13 pts. 10,017
  2. Avatar for reefyrob 12. reefyrob Lv 1 10 pts. 10,015
  3. Avatar for ZeroLeak7 13. ZeroLeak7 Lv 1 7 pts. 9,993
  4. Avatar for Galaxie 14. Galaxie Lv 1 6 pts. 9,957
  5. Avatar for Deleted player 15. Deleted player pts. 9,946
  6. Avatar for robgee 16. robgee Lv 1 3 pts. 9,939
  7. Avatar for retiredmichael 17. retiredmichael Lv 1 2 pts. 9,926
  8. Avatar for alcor29 18. alcor29 Lv 1 2 pts. 9,926
  9. Avatar for phi16 19. phi16 Lv 1 1 pt. 9,901
  10. Avatar for jausmh 20. jausmh Lv 1 1 pt. 9,838

Comments