Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,107
  2. Avatar for Go Science 2. Go Science 71 pts. 10,106
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,031
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 10,017
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 9,957
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,841
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,710
  8. Avatar for Contenders 8. Contenders 5 pts. 9,620
  9. Avatar for Mojo Risin' 9. Mojo Risin' 3 pts. 8,979
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 2 pts. 8,745

  1. Avatar for JMStiffler 21. JMStiffler Lv 1 1 pt. 9,819
  2. Avatar for TastyMunchies 22. TastyMunchies Lv 1 1 pt. 9,784
  3. Avatar for Deleted player 23. Deleted player pts. 9,774
  4. Avatar for ManVsYard 24. ManVsYard Lv 1 1 pt. 9,767
  5. Avatar for dbuske 25. dbuske Lv 1 1 pt. 9,653
  6. Avatar for atlas100 26. atlas100 Lv 1 1 pt. 9,597
  7. Avatar for Vincera 27. Vincera Lv 1 1 pt. 9,477
  8. Avatar for christioanchauvin 28. christioanchauvin Lv 1 1 pt. 9,461
  9. Avatar for alwen 29. alwen Lv 1 1 pt. 9,283
  10. Avatar for nicobul 30. nicobul Lv 1 1 pt. 8,868

Comments