Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,107
  2. Avatar for Go Science 2. Go Science 71 pts. 10,106
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,031
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 10,017
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 9,957
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,841
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,710
  8. Avatar for Contenders 8. Contenders 5 pts. 9,620
  9. Avatar for Mojo Risin' 9. Mojo Risin' 3 pts. 8,979
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 2 pts. 8,745

  1. Avatar for sciencewalker 81. sciencewalker Lv 1 4 pts. 8,943
  2. Avatar for momadoc 82. momadoc Lv 1 3 pts. 8,943
  3. Avatar for tomespen 83. tomespen Lv 1 3 pts. 8,936
  4. Avatar for Deleted player 84. Deleted player pts. 8,920
  5. Avatar for Superphosphate 85. Superphosphate Lv 1 3 pts. 8,883
  6. Avatar for Vincera 86. Vincera Lv 1 3 pts. 8,881
  7. Avatar for MsHsi 87. MsHsi Lv 1 3 pts. 8,858
  8. Avatar for SaraL 88. SaraL Lv 1 2 pts. 8,856
  9. Avatar for ManVsYard 89. ManVsYard Lv 1 2 pts. 8,854
  10. Avatar for rinze 90. rinze Lv 1 2 pts. 8,844

Comments