Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 4 pts. 9,898
  2. Avatar for Team Schleswig-Holstein 12. Team Schleswig-Holstein 3 pts. 9,826
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 9,718
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 9,682
  6. Avatar for Team China 16. Team China 1 pt. 9,603
  7. Avatar for Deleted group 17. Deleted group pts. 9,517
  8. Avatar for freefolder 18. freefolder 1 pt. 9,405
  9. Avatar for 7Monkeys 19. 7Monkeys 1 pt. 9,333
  10. Avatar for Russian team 20. Russian team 1 pt. 9,236
  1. Avatar for Timo van der Laan
    1. Timo van der Laan Lv 1
    100 pts. 10,465
  2. Avatar for bertro 2. bertro Lv 1 97 pts. 10,463
  3. Avatar for Bletchley Park 3. Bletchley Park Lv 1 94 pts. 10,461
  4. Avatar for pvc78 4. pvc78 Lv 1 91 pts. 10,441
  5. Avatar for smilingone 5. smilingone Lv 1 88 pts. 10,439
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 85 pts. 10,433
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 82 pts. 10,427
  8. Avatar for Galaxie 8. Galaxie Lv 1 79 pts. 10,423
  9. Avatar for Aubade01 9. Aubade01 Lv 1 77 pts. 10,414
  10. Avatar for LociOiling 10. LociOiling Lv 1 74 pts. 10,408

Comments