Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,478
  2. Avatar for Void Crushers 2. Void Crushers 79 pts. 10,465
  3. Avatar for Contenders 3. Contenders 61 pts. 10,461
  4. Avatar for Go Science 4. Go Science 47 pts. 10,433
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 35 pts. 10,423
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 10,373
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 19 pts. 10,331
  8. Avatar for Marvin's bunch 8. Marvin's bunch 14 pts. 10,328
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,296
  10. Avatar for Trinity Biology 10. Trinity Biology 7 pts. 9,934
  1. Avatar for Timo van der Laan
    1. Timo van der Laan Lv 1
    100 pts. 10,465
  2. Avatar for bertro 2. bertro Lv 1 97 pts. 10,463
  3. Avatar for Bletchley Park 3. Bletchley Park Lv 1 94 pts. 10,461
  4. Avatar for pvc78 4. pvc78 Lv 1 91 pts. 10,441
  5. Avatar for smilingone 5. smilingone Lv 1 88 pts. 10,439
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 85 pts. 10,433
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 82 pts. 10,427
  8. Avatar for Galaxie 8. Galaxie Lv 1 79 pts. 10,423
  9. Avatar for Aubade01 9. Aubade01 Lv 1 77 pts. 10,414
  10. Avatar for LociOiling 10. LociOiling Lv 1 74 pts. 10,408

Comments