Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,046
  2. Avatar for Window Group 22. Window Group 1 pt. 3,046
  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 10,478
  2. Avatar for LociOiling 2. LociOiling Lv 1 83 pts. 10,474
  3. Avatar for bertro 3. bertro Lv 1 69 pts. 10,454
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 56 pts. 10,453
  5. Avatar for reefyrob 5. reefyrob Lv 1 45 pts. 10,446
  6. Avatar for toshiue 6. toshiue Lv 1 36 pts. 10,433
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 29 pts. 10,431
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 23 pts. 10,428
  9. Avatar for Galaxie 9. Galaxie Lv 1 18 pts. 10,423
  10. Avatar for pauldunn 10. pauldunn Lv 1 14 pts. 10,418

Comments