Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,046
  2. Avatar for Window Group 22. Window Group 1 pt. 3,046
  1. Avatar for Auntecedent 101. Auntecedent Lv 1 1 pt. 9,654
  2. Avatar for yoyoparis 102. yoyoparis Lv 1 1 pt. 9,646
  3. Avatar for Museka 103. Museka Lv 1 1 pt. 9,605
  4. Avatar for Kevin76 104. Kevin76 Lv 1 1 pt. 9,603
  5. Avatar for alwen 105. alwen Lv 1 1 pt. 9,599
  6. Avatar for antibot215 106. antibot215 Lv 1 1 pt. 9,592
  7. Avatar for Knoblerine 107. Knoblerine Lv 1 1 pt. 9,574
  8. Avatar for rabamino12358 108. rabamino12358 Lv 1 1 pt. 9,573
  9. Avatar for TheStaticSloth 109. TheStaticSloth Lv 1 1 pt. 9,545
  10. Avatar for SaraL 110. SaraL Lv 1 1 pt. 9,536

Comments