Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,046
  2. Avatar for Window Group 22. Window Group 1 pt. 3,046
  1. Avatar for momadoc 111. momadoc Lv 1 1 pt. 9,528
  2. Avatar for The_Otterable 112. The_Otterable Lv 1 1 pt. 9,517
  3. Avatar for ivalnic 113. ivalnic Lv 1 1 pt. 9,514
  4. Avatar for gstelle 114. gstelle Lv 1 1 pt. 9,514
  5. Avatar for martinf 115. martinf Lv 1 1 pt. 9,508
  6. Avatar for rinze 116. rinze Lv 1 1 pt. 9,488
  7. Avatar for DipsyDoodle2016 117. DipsyDoodle2016 Lv 1 1 pt. 9,477
  8. Avatar for Snake bite 118. Snake bite Lv 1 1 pt. 9,475
  9. Avatar for multaq 119. multaq Lv 1 1 pt. 9,466
  10. Avatar for roman madala 120. roman madala Lv 1 1 pt. 9,438

Comments