Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,046
  2. Avatar for Window Group 22. Window Group 1 pt. 3,046

  1. Avatar for lamoille 131. lamoille Lv 1 1 pt. 9,187
  2. Avatar for wozzarelli 132. wozzarelli Lv 1 1 pt. 9,158
  3. Avatar for jerry78424 133. jerry78424 Lv 1 1 pt. 9,119
  4. Avatar for AtOneMent 134. AtOneMent Lv 1 1 pt. 9,066
  5. Avatar for doctaven 135. doctaven Lv 1 1 pt. 9,046
  6. Avatar for baiyuncanggou 136. baiyuncanggou Lv 1 1 pt. 9,041
  7. Avatar for ryoken329 138. ryoken329 Lv 1 1 pt. 9,010
  8. Avatar for Anamfija 139. Anamfija Lv 1 1 pt. 9,000
  9. Avatar for Mike Cassidy 140. Mike Cassidy Lv 1 1 pt. 8,978

Comments