Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,046
  2. Avatar for Window Group 22. Window Group 1 pt. 3,046
  1. Avatar for ZeroLeak7 11. ZeroLeak7 Lv 1 71 pts. 10,387
  2. Avatar for phi16 12. phi16 Lv 1 69 pts. 10,373
  3. Avatar for mirp 13. mirp Lv 1 67 pts. 10,367
  4. Avatar for Deleted player 14. Deleted player pts. 10,360
  5. Avatar for weitzen 15. weitzen Lv 1 62 pts. 10,352
  6. Avatar for crpainter 16. crpainter Lv 1 60 pts. 10,347
  7. Avatar for altejoh 17. altejoh Lv 1 58 pts. 10,342
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 56 pts. 10,337
  9. Avatar for robgee 19. robgee Lv 1 54 pts. 10,335
  10. Avatar for Superphosphate 20. Superphosphate Lv 1 52 pts. 10,331

Comments