Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,046
  2. Avatar for Window Group 22. Window Group 1 pt. 3,046

  1. Avatar for cobaltteal 31. cobaltteal Lv 1 34 pts. 10,292
  2. Avatar for dcrwheeler 32. dcrwheeler Lv 1 32 pts. 10,286
  3. Avatar for grogar7 33. grogar7 Lv 1 31 pts. 10,276
  4. Avatar for JSmith48 34. JSmith48 Lv 1 30 pts. 10,271
  5. Avatar for johngran 35. johngran Lv 1 28 pts. 10,266
  6. Avatar for DoctorSockrates 36. DoctorSockrates Lv 1 27 pts. 10,265
  7. Avatar for MicElephant 37. MicElephant Lv 1 26 pts. 10,249
  8. Avatar for christioanchauvin 38. christioanchauvin Lv 1 25 pts. 10,233
  9. Avatar for Tehnologik1 39. Tehnologik1 Lv 1 24 pts. 10,233
  10. Avatar for pauldunn 40. pauldunn Lv 1 23 pts. 10,230

Comments