Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,046
  2. Avatar for Window Group 22. Window Group 1 pt. 3,046

  1. Avatar for khalan.ysatis 81. khalan.ysatis Lv 1 3 pts. 9,922
  2. Avatar for Tlaloc 82. Tlaloc Lv 1 3 pts. 9,898
  3. Avatar for jamiexq 83. jamiexq Lv 1 2 pts. 9,875
  4. Avatar for kludbrook 84. kludbrook Lv 1 2 pts. 9,853
  5. Avatar for jakestorm777 85. jakestorm777 Lv 1 2 pts. 9,851
  6. Avatar for Pibeagles 86. Pibeagles Lv 1 2 pts. 9,846
  7. Avatar for Bithalbierer 87. Bithalbierer Lv 1 2 pts. 9,826
  8. Avatar for hada 88. hada Lv 1 2 pts. 9,811
  9. Avatar for JasperD 89. JasperD Lv 1 2 pts. 9,808
  10. Avatar for ViJay7019 90. ViJay7019 Lv 1 2 pts. 9,776

Comments