Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,478
  2. Avatar for Void Crushers 2. Void Crushers 79 pts. 10,465
  3. Avatar for Contenders 3. Contenders 61 pts. 10,461
  4. Avatar for Go Science 4. Go Science 47 pts. 10,433
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 35 pts. 10,423
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 10,373
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 19 pts. 10,331
  8. Avatar for Marvin's bunch 8. Marvin's bunch 14 pts. 10,328
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,296
  10. Avatar for Trinity Biology 10. Trinity Biology 7 pts. 9,934
  1. Avatar for mirp 11. mirp Lv 1 10 pts. 10,418
  2. Avatar for Deleted player 12. Deleted player pts. 10,407
  3. Avatar for phi16 13. phi16 Lv 1 6 pts. 10,388
  4. Avatar for lamoille 14. lamoille Lv 1 4 pts. 10,377
  5. Avatar for actiasluna 15. actiasluna Lv 1 3 pts. 10,373
  6. Avatar for robgee 16. robgee Lv 1 2 pts. 10,369
  7. Avatar for alcor29 17. alcor29 Lv 1 2 pts. 10,364
  8. Avatar for alwen 18. alwen Lv 1 1 pt. 10,359
  9. Avatar for Blipperman 19. Blipperman Lv 1 1 pt. 10,356
  10. Avatar for ManVsYard 20. ManVsYard Lv 1 1 pt. 10,334

Comments