Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Beta Folders 100 pts. 10,478
  2. Avatar for Void Crushers 2. Void Crushers 79 pts. 10,465
  3. Avatar for Contenders 3. Contenders 61 pts. 10,461
  4. Avatar for Go Science 4. Go Science 47 pts. 10,433
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 35 pts. 10,423
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 10,373
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 19 pts. 10,331
  8. Avatar for Marvin's bunch 8. Marvin's bunch 14 pts. 10,328
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,296
  10. Avatar for Trinity Biology 10. Trinity Biology 7 pts. 9,934

  1. Avatar for nicobul 21. nicobul Lv 1 50 pts. 10,331
  2. Avatar for johnmitch 22. johnmitch Lv 1 48 pts. 10,328
  3. Avatar for hpaege 23. hpaege Lv 1 46 pts. 10,327
  4. Avatar for frood66 24. frood66 Lv 1 44 pts. 10,326
  5. Avatar for Norrjane 25. Norrjane Lv 1 43 pts. 10,308
  6. Avatar for fiendish_ghoul 26. fiendish_ghoul Lv 1 41 pts. 10,306
  7. Avatar for Blipperman 27. Blipperman Lv 1 39 pts. 10,306
  8. Avatar for WBarme1234 28. WBarme1234 Lv 1 38 pts. 10,300
  9. Avatar for actiasluna 29. actiasluna Lv 1 36 pts. 10,297
  10. Avatar for O Seki To 30. O Seki To Lv 1 35 pts. 10,296

Comments