Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 9,179
  2. Avatar for Russian team 12. Russian team 1 pt. 9,114
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,540
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,800
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 7,172
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 5,048
  7. Avatar for Team China 17. Team China 1 pt. 0
  1. Avatar for actiasluna
    1. actiasluna Lv 1
    100 pts. 10,760
  2. Avatar for eusair 2. eusair Lv 1 97 pts. 10,627
  3. Avatar for dcrwheeler 3. dcrwheeler Lv 1 93 pts. 10,604
  4. Avatar for bertro 4. bertro Lv 1 90 pts. 10,589
  5. Avatar for mirp 5. mirp Lv 1 87 pts. 10,566
  6. Avatar for Galaxie 6. Galaxie Lv 1 84 pts. 10,558
  7. Avatar for LociOiling 7. LociOiling Lv 1 81 pts. 10,537
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 78 pts. 10,529
  9. Avatar for fiendish_ghoul 9. fiendish_ghoul Lv 1 75 pts. 10,503
  10. Avatar for nicobul 10. nicobul Lv 1 72 pts. 10,496

Comments