Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,760
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,593
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,578
  4. Avatar for Go Science 4. Go Science 36 pts. 10,566
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,496
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,353
  7. Avatar for Contenders 7. Contenders 10 pts. 10,287
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 10,249
  9. Avatar for Team Schleswig-Holstein 9. Team Schleswig-Holstein 4 pts. 9,289
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,269
  1. Avatar for actiasluna
    1. actiasluna Lv 1
    100 pts. 10,760
  2. Avatar for eusair 2. eusair Lv 1 97 pts. 10,627
  3. Avatar for dcrwheeler 3. dcrwheeler Lv 1 93 pts. 10,604
  4. Avatar for bertro 4. bertro Lv 1 90 pts. 10,589
  5. Avatar for mirp 5. mirp Lv 1 87 pts. 10,566
  6. Avatar for Galaxie 6. Galaxie Lv 1 84 pts. 10,558
  7. Avatar for LociOiling 7. LociOiling Lv 1 81 pts. 10,537
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 78 pts. 10,529
  9. Avatar for fiendish_ghoul 9. fiendish_ghoul Lv 1 75 pts. 10,503
  10. Avatar for nicobul 10. nicobul Lv 1 72 pts. 10,496

Comments