Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,760
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,593
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,578
  4. Avatar for Go Science 4. Go Science 36 pts. 10,566
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,496
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,353
  7. Avatar for Contenders 7. Contenders 10 pts. 10,287
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 10,249
  9. Avatar for Team Schleswig-Holstein 9. Team Schleswig-Holstein 4 pts. 9,289
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,269
  1. Avatar for ManVsYard
    1. ManVsYard Lv 1
    100 pts. 10,747
  2. Avatar for Blipperman 2. Blipperman Lv 1 83 pts. 10,682
  3. Avatar for LociOiling 3. LociOiling Lv 1 69 pts. 10,593
  4. Avatar for smilingone 4. smilingone Lv 1 56 pts. 10,590
  5. Avatar for Galaxie 5. Galaxie Lv 1 45 pts. 10,578
  6. Avatar for robgee 6. robgee Lv 1 36 pts. 10,568
  7. Avatar for alwen 7. alwen Lv 1 29 pts. 10,568
  8. Avatar for lamoille 8. lamoille Lv 1 23 pts. 10,567
  9. Avatar for toshiue 9. toshiue Lv 1 18 pts. 10,563
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 14 pts. 10,561

Comments