Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,760
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,593
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,578
  4. Avatar for Go Science 4. Go Science 36 pts. 10,566
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,496
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,353
  7. Avatar for Contenders 7. Contenders 10 pts. 10,287
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 10,249
  9. Avatar for Team Schleswig-Holstein 9. Team Schleswig-Holstein 4 pts. 9,289
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,269
  1. Avatar for Hollinas 11. Hollinas Lv 1 10 pts. 10,560
  2. Avatar for mirp 12. mirp Lv 1 8 pts. 10,529
  3. Avatar for sciencewalker 13. sciencewalker Lv 1 6 pts. 10,524
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 4 pts. 10,522
  5. Avatar for phi16 15. phi16 Lv 1 3 pts. 10,500
  6. Avatar for alcor29 16. alcor29 Lv 1 2 pts. 10,487
  7. Avatar for Alistair69 17. Alistair69 Lv 1 2 pts. 10,443
  8. Avatar for manu8170 18. manu8170 Lv 1 1 pt. 10,443
  9. Avatar for Anfinsen_slept_here 19. Anfinsen_slept_here Lv 1 1 pt. 10,439
  10. Avatar for Vincera 20. Vincera Lv 1 1 pt. 10,428

Comments