Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,760
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,593
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,578
  4. Avatar for Go Science 4. Go Science 36 pts. 10,566
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,496
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,353
  7. Avatar for Contenders 7. Contenders 10 pts. 10,287
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 10,249
  9. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,269

  1. Avatar for joremen 41. joremen Lv 1 19 pts. 9,926
  2. Avatar for Flagg65a 42. Flagg65a Lv 1 18 pts. 9,855
  3. Avatar for diamonddays 43. diamonddays Lv 1 17 pts. 9,834
  4. Avatar for Steven Pletsch 44. Steven Pletsch Lv 1 16 pts. 9,831
  5. Avatar for SaraL 45. SaraL Lv 1 15 pts. 9,829
  6. Avatar for boondog 46. boondog Lv 1 14 pts. 9,820
  7. Avatar for Deleted player 47. Deleted player pts. 9,807
  8. Avatar for YGK 48. YGK Lv 1 13 pts. 9,791
  9. Avatar for andrewtmaxwell 49. andrewtmaxwell Lv 1 12 pts. 9,779
  10. Avatar for jausmh 50. jausmh Lv 1 12 pts. 9,774

Comments