Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,760
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,593
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,578
  4. Avatar for Go Science 4. Go Science 36 pts. 10,566
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,496
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,353
  7. Avatar for Contenders 7. Contenders 10 pts. 10,287
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 10,249
  9. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,269

  1. Avatar for Bithalbierer 71. Bithalbierer Lv 1 3 pts. 9,289
  2. Avatar for JasperD 72. JasperD Lv 1 3 pts. 9,269
  3. Avatar for GaryForbis 73. GaryForbis Lv 1 3 pts. 9,222
  4. Avatar for momadoc 74. momadoc Lv 1 3 pts. 9,205
  5. Avatar for Knoblerine 75. Knoblerine Lv 1 3 pts. 9,191
  6. Avatar for Tlaloc 76. Tlaloc Lv 1 2 pts. 9,179
  7. Avatar for Alistair69 77. Alistair69 Lv 1 2 pts. 9,176
  8. Avatar for Znaika 78. Znaika Lv 1 2 pts. 9,114
  9. Avatar for kludbrook 79. kludbrook Lv 1 2 pts. 9,090
  10. Avatar for pfeiffelfloyd 80. pfeiffelfloyd Lv 1 2 pts. 9,052

Comments